site stats

Four and a half lim domains protein 1

WebSep 27, 2010 · Four and a half LIM domain protein 1 (FHL1) is the founding member of the FHL family of proteins characterized by the presence of four and a half highly conserved LIM domains. The LIM domain is a protein-interaction motif and is involved in linking proteins with both the actin cytoskeleton and transcriptional machinery. To date, … Webfour and a half LIM domains 1 Normal Function The FHL1 gene provides instructions for making three versions (isoforms) of a protein that plays an important role in muscles used for movement (skeletal muscles) and in the heart (cardiac muscle). The full-length isoform is known as FHL1A, or sometimes just FHL1.

The four and a half LIM domains 2 (FHL2) regulates ovarian …

WebItem Pigeon Four and A Half LIM Domains Protein 1 ELISA Kit; Company MyBioSource.com; Price Pricing Info Supplier Page View Company Product Page; … WebThe fourth LIM domain of Four and a half LIM domains protein 1 (FHL1): FHL1 is heavily expressed in skeletal and cardiac muscles. It plays important roles in muscle growth, differentiation, and sarcomere assembly by acting as a modulator of transcription factors. ararat train museum https://signaturejh.com

Cells Free Full-Text Four-And-A-Half LIM-Domain Protein 2 …

WebDec 21, 2004 · Four and a half LIM domains protein 5 Short names FHL-5 Alternative names Activator of cAMP-responsive element modulator in testis ( Activator of CREM in testis) Gene names Name FHL5 Synonyms ACT Organism names Organism Homo sapiens (Human) Taxonomic identifier 9606 NCBI Taxonomic lineage WebIntroduction: Four and a half LIM domains protein 1 (FHL1) is the most widely expressed member of the FHL family of proteins, consisting of four and a half highly conserved LIM … WebMay 15, 2024 · Four and a half LIM domain protein 1 (FHL1), the founding member of the FHL protein family, is composed of four and a half highly conserved LIM domains with … baked au gratin

Proline-, Glutamic Acid-, and Leucine-Rich Protein-1/Modulator of ...

Category:Entry - *605126 - FOUR-AND-A-HALF LIM DOMAINS 5; FHL5

Tags:Four and a half lim domains protein 1

Four and a half lim domains protein 1

FHL1 - Wikipedia

WebFour-and-a-half LIM domain 1 gene (FHL1) has recently been identified as the causative gene for reducing body myopathy (RBM), X-linked scapuloperoneal myopathy (SPM) and X-linked myopathy with postural muscle atrophy (XMPMA). Rigid spine is a common clinical feature of the three diseases. We searched for FHL1 mutations in eighteen patients … WebNational Center for Biotechnology Information

Four and a half lim domains protein 1

Did you know?

WebUsing a yeast two-hybrid screen, we found that fourand-a-half LIM-only protein 2 (FHL2) interacted with PELP1. FHL2 is a transcriptional regulator that associates with nuclear cofactors, including androgen receptors (ARs), and contains an intrinsic more »... tion domain. PELP1 and FHL2 interact in vitro and in vivo and colocalize in the ... WebSep 21, 2004 · The deduced 284-amino acid protein contains an N-terminal half-LIM domain followed by 4 LIM domains. ACT shares 58.5% identity with FHL2 and 85% identity with mouse Act. Northern blot analysis revealed moderate to high levels of expression in all squamous cell carcinoma, melanoma, and leukemia tumor cell lines tested.

WebMar 27, 2024 · FOUR-AND-A-HALF LIM DOMAINS 1; FHL1 Alternative titles; symbols SLIM1 FHL1A KYOT, MOUSE, HOMOLOG OF Other entities represented in this entry: … WebApr 5, 2024 · Four and a half LIM domains 2 (FHL2) is a multifunctional protein that functions as an adaptor or scaffold to support the assembly of multi-protein complexes for critical cellular processes ...

WebFour-and-a-half LIM domain 1 (FHL1), is a member of the gene family encoding LIM domain containing proteins. A LIM domain is mainly constituted of two cysteine-rich zinc-finger motifs, which coordinately … WebMar 29, 2024 · Some reports have shown a direct binding of LIM domain-containing proteins, such as the four and a half LIM domain protein 2 (FHL-2), to β integrin cytoplasmic tails 41.

WebJun 20, 2024 · Four and a half LIM domain (FHL) protein family members, FHL1 and FHL2, are multifunctional proteins that are enriched in cardiac muscle. Although they both localize within the cardiomyocyte sarcomere (titin N2B), they have been shown to have important yet unique functions within the context of cardiac hypertrophy and disease.

WebJan 2, 2006 · The human four-and-a-half-LIM-only protein family consists of the members FHL1, FHL2, FHL3, FHL4 and ACT. They are expressed in a cell- and tissue-specific manner and participate in various cellular processes, including regulation of cell survival, transcription and signal transduction. ... that the HCF-1-processing domain interacts with ... baked au gratin potatoesFour and a half LIM domains protein 1 is a protein that in humans is encoded by the FHL1 gene. baked bagel san diegoWebJun 20, 2024 · Four and a half LIM domain (FHL) protein family members, FHL1 and FHL2, are multifunctional proteins that are enriched in cardiac muscle. Although they … ararat usaWebSep 21, 2004 · The deduced 284-amino acid protein contains an N-terminal half-LIM domain followed by 4 LIM domains. ACT shares 58.5% identity with FHL2 and 85% … baked bagsWebGene ID: 125353669, updated on 20-May-2024. Summary Other designations. four and a half LIM domains protein 1-like ararat vaspurakan brandyWebaa seq: 320 aa aa seq db search maekfdchycrdplqgkkyvekdghhcclkcfdkfcantcvecrkpigadskevhyknrf whdtcfrcakcfhplasetfvakdnkilcnkcatrgdenprckgcfkalvagdqnveykg ... ararat ukraineWebLIM-only protein 4 (LMO4) and LIM-domain binding protein 1. Squamous cell carcinoma of the head and neck (HNSCC) accounts for more than 300,000 deaths worldwide per … ararat trekking